Hooke Kits™ for EAE Induction in C57BL/6 Mice

Also for EAE induction in (C57BL/6 x SJL)F1 mice

Emulsion supplied in pre-filled syringes, ready to use.

Consistently induces EAE in female C57BL/6 mice

EAE develops in 90 to 100% of untreated mice. In most mice disease onset occurs between 9 and 16 days after immunization. Most mice will reach a maximum score of 3.0 to 3.5.

Each lot is tested and individually adjusted to ensure consistent disease induction.

On Day 0, MOG_35-55/CFA or MOG_1-125/CFA emulsion and pertussis toxin are injected.
On Day 1, a second dose of pertussis toxin is injected.

Eliminates tedious preparation of emulsions

Properly prepared emulsions are critical for reliable induction of many autoimmune disease models. Our emulsions are carefully made and pre-filled into syringes, ready to use, to reduce time needed to set up experiments.

Saves time and mice in testing individual reagents

Lot-to-lot reagent variations can cause dramatic changes in severity of induced autoimmune disease. The consistent potency of pre-characterized Hooke Kits™ eliminates time-consuming testing.

Reduces your mouse facility's exposure to pathogen contamination

Pre-filled syringes are prepared under aseptic conditions and delivered in sterilized plastic bags for easy disinfection before introduction into your mouse facility.

Experimental autoimmune encephalomyelitis (EAE) is the model most commonly used to study efficacy of potential drugs for treatment of multiple sclerosis (MS).

Because of its many similarities to MS, EAE is used to study pathogenesis of autoimmunity, CNS inflammation, demyelination, cell trafficking and tolerance induction.

EAE is characterized by paralysis (in some models the paralysis is relapsing-remitting), CNS inflammation and demyelination. EAE is initiated by myelin-specific CD4+ T cells, with glia cells (microglia and astrocytes), B cells, macrophages, NK cells, and dendritic cells all playing important roles in disease development.

Kit selection

MOG_35-55 antigen (EK-2110) is recommended for study of onset and development of EAE and testing efficacy of potential therapeutics. The induced immune response will be directed against a single epitope. This antigen will consistently induce T cell responses, but will not consistently induce B cell responses, and as a result there will be no consistent anti-MOG_35-55 antibody production. EAE severity does not correlate with antibody production. EAE induced with this emulsion is not B cell dependent.

MOG_1-125 antigen (EK-2160) induces a response directed against multiple epitopes and will induce consistent anti-MOG_1-125 antibody production. EAE induced with this emulsion is B cell dependent. Our EK-2160 kit is therefore recommended for testing therapeutics which specifically target B cells [1, 2, 3].

For more information on model and antigen selection, please see Learning Center - What are the advantages and disadvantages of the different EAE models and antigens?.

Cat #	Hooke Kit™	Strain	Age	Description	Size	Price (first kit)	Price (each add'l kit)
EK-2110	MOG_35-55/CFA Emulsion PTX	C57BL/6	9 to 13 weeks	Emulsion in syringes, PTX	10 mice	$ 399	$ 339
EK-2160	MOG_1-125/CFA Emulsion PTX	C57BL/6	9 to 13 weeks	Emulsion in syringes, PTX	10 mice	$ 2087	$ 1668

These kits can be customized for a small additional charge. Contact us at or with your requirements.

With a given Hooke Kit™, older mice generally develop more severe disease and more uniform disease onset.

Protocol

EAE Induction by Active Immunization in C57BL/6 Mice

Note: These kits may also be used to induce EAE in in (C57BL/6 x SJL)F1 mice.

Detailed contents

Each kit provides sufficient reagents for 10 mice.

EK-2110 antigen is myelin oligodendrocyte glycoprotein 35-55 (MOG_35-55) rat, mouse, sequence MEVGWYRSPFSRVVHLYRNGK.

EK-2160 antigen is human recombinant myelin oligodendrocyte glycoprotein 1-125 (MOG_1-125), sequence MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGG
FTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH.

Qty	Description
3	Syringes pre-filled with 0.7 mL antigen/CFA emulsion ~ 1 mg MOG_35-55/mL emulsion (EK-2110) ~ 0.5 mg MOG_1-125/mL emulsion (EK-2160) ~ 1 to 5 mg killed mycobacterium tuberculosis H37Ra/mL emulsion (all concentrations adjusted by lot for consistent EAE induction)
1	Vial containing 3 to 6 µg pertussis toxin (PTX) in glycerol buffer (amount is adjusted by lot for consistent EAE induction; see protocol)
1	Data sheet: Recommended experimental protocol, typical results

Typical results

Results graph

EAE induction in C57BL/6 mice

Protocol: EAE Induction by Active Immunization in C57BL/6 Mice

Data are from three independent groups in a single experiment. Immunization used Hooke Kit™ MOG_35-55/CFA Emulsion PTX (EK-2110), with 11 to 13 week old female C57BL/6 mice (Taconic Biosciences).

Pertussis toxin from 3 vials was pooled before administration.

Similar results are obtained using C57BL/6 mice from The Jackson Laboratory, as well as with MOG_1-125/CFA Emulsion PTX (EK-2160) using the recommended protocol.